2016-03-10 02:26:59 +00:00
|
|
|
<!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN"
|
|
|
|
|
"http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd">
|
|
|
|
|
<html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en" lang="en">
|
|
|
|
|
<head>
|
|
|
|
|
<meta http-equiv="Content-Type" content="text/html; charset=UTF-8" />
|
|
|
|
|
<title>
|
|
|
|
|
File: README
|
|
|
|
|
|
|
|
|
|
— Documentation by YARD 0.8.7.6
|
|
|
|
|
|
|
|
|
|
</title>
|
|
|
|
|
|
|
|
|
|
<link rel="stylesheet" href="css/style.css" type="text/css" charset="utf-8" />
|
|
|
|
|
|
|
|
|
|
<link rel="stylesheet" href="css/common.css" type="text/css" charset="utf-8" />
|
|
|
|
|
|
|
|
|
|
<script type="text/javascript" charset="utf-8">
|
|
|
|
|
hasFrames = window.top.frames.main ? true : false;
|
|
|
|
|
relpath = '';
|
|
|
|
|
framesUrl = "frames.html#!file.README.html";
|
|
|
|
|
</script>
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
<script type="text/javascript" charset="utf-8" src="js/jquery.js"></script>
|
|
|
|
|
|
|
|
|
|
<script type="text/javascript" charset="utf-8" src="js/app.js"></script>
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
</head>
|
|
|
|
|
<body>
|
|
|
|
|
<div id="header">
|
|
|
|
|
<div id="menu">
|
|
|
|
|
|
|
|
|
|
<a href="_index.html">Index</a> »
|
|
|
|
|
<span class="title">File: README</span>
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
<div class="noframes"><span class="title">(</span><a href="." target="_top">no frames</a><span class="title">)</span></div>
|
|
|
|
|
</div>
|
|
|
|
|
|
|
|
|
|
<div id="search">
|
|
|
|
|
|
|
|
|
|
<a class="full_list_link" id="class_list_link"
|
|
|
|
|
href="class_list.html">
|
|
|
|
|
Class List
|
|
|
|
|
</a>
|
|
|
|
|
|
|
|
|
|
<a class="full_list_link" id="method_list_link"
|
|
|
|
|
href="method_list.html">
|
|
|
|
|
Method List
|
|
|
|
|
</a>
|
|
|
|
|
|
|
|
|
|
<a class="full_list_link" id="file_list_link"
|
|
|
|
|
href="file_list.html">
|
|
|
|
|
File List
|
|
|
|
|
</a>
|
|
|
|
|
|
|
|
|
|
</div>
|
|
|
|
|
<div class="clear"></div>
|
|
|
|
|
</div>
|
|
|
|
|
|
|
|
|
|
<iframe id="search_frame"></iframe>
|
|
|
|
|
|
|
|
|
|
<div id="content"><div id='filecontents'>
|
|
|
|
|
<p><a href="http://classyfire.wishartlab.com">ClassyFire</a> is a resource
|
|
|
|
|
that allows you to automatically classify any chemical compound based on
|
|
|
|
|
its structure. This is the repository for the ClassyFire API allows you to
|
|
|
|
|
send requests to and pull information from the ClassyFire web server.</p>
|
|
|
|
|
|
|
|
|
|
<h1 id="label-What+is+this+repository+for-3F"><strong>What is this repository for?</strong></h1>
|
|
|
|
|
<ul><li>
|
|
|
|
|
<p>Quick summary</p>
|
|
|
|
|
</li><li>
|
|
|
|
|
<p>Version</p>
|
|
|
|
|
</li><li>
|
|
|
|
|
<p><a href="https://bitbucket.org/tutorials/markdowndemo">Learn Markdown</a></p>
|
|
|
|
|
</li></ul>
|
|
|
|
|
|
|
|
|
|
<h1 id="label-How+do+I+get+set+up-3F"><strong>How do I get set up?</strong></h1>
|
|
|
|
|
<ul><li>
|
|
|
|
|
<p>Summary of set up</p>
|
|
|
|
|
</li><li>
|
|
|
|
|
<p>Configuration</p>
|
|
|
|
|
</li><li>
|
|
|
|
|
<p>Dependencies</p>
|
|
|
|
|
</li><li>
|
|
|
|
|
<p>Database configuration</p>
|
|
|
|
|
</li><li>
|
|
|
|
|
<p>How to run tests</p>
|
|
|
|
|
</li><li>
|
|
|
|
|
<p>Deployment instructions</p>
|
|
|
|
|
</li></ul>
|
|
|
|
|
|
|
|
|
|
<h1 id="label-Contribution+guidelines"><strong>Contribution guidelines</strong></h1>
|
|
|
|
|
<ul><li>
|
|
|
|
|
<p>Writing tests</p>
|
|
|
|
|
</li><li>
|
|
|
|
|
<p>Code review</p>
|
|
|
|
|
</li><li>
|
|
|
|
|
<p>Other guidelines</p>
|
|
|
|
|
</li></ul>
|
|
|
|
|
|
|
|
|
|
<h1 id="label-Endpoints"><strong>Endpoints</strong></h1>
|
|
|
|
|
|
|
|
|
|
<blockquote>
|
|
|
|
|
<h2 id="label-1.+Entity">1. Entity</h2>
|
|
|
|
|
|
|
|
|
|
<blockquote>
|
|
|
|
|
<p>Chemical compounds are represented by the Entity model, through which one
|
|
|
|
|
can access the compound's structure-based classification.</p>
|
|
|
|
|
|
|
|
|
|
<h3 id="label-GET">GET</h3>
|
|
|
|
|
|
|
|
|
|
<p><strong>/entities/entityInchikey</strong></p>
|
|
|
|
|
|
|
|
|
|
<p>A chemical compound's classification can be retrieved in the JSON or
|
|
|
|
|
XML format. The compound's information is accessed via the InChIkey as
|
|
|
|
|
show in the following examples. In this example, the entity has the
|
|
|
|
|
InChIKey=LABTWGUMFABVFG-ONEGZZNKSA-N.</p>
|
|
|
|
|
|
|
|
|
|
<blockquote>
|
|
|
|
|
<p>ClassyFireAPI.get_entity_classification(“BDAGIHXWWSANSR-UHFFFAOYSA-N”,“json”)</p>
|
|
|
|
|
</blockquote>
|
|
|
|
|
|
|
|
|
|
<p>Where:</p>
|
|
|
|
|
|
|
|
|
|
<blockquote>
|
|
|
|
|
<p>The entity's InChIKey is “BDAGIHXWWSANSR-UHFFFAOYSA-N”,</p>
|
|
|
|
|
|
|
|
|
|
<p>The output format is “json” (JSON).</p>
|
|
|
|
|
</blockquote>
|
|
|
|
|
</blockquote>
|
|
|
|
|
|
2016-03-10 02:50:36 +00:00
|
|
|
<h2 id="label-2.+Sequence">2. Sequence</h2>
|
|
|
|
|
|
|
|
|
|
<blockquote>
|
|
|
|
|
<p>Sequences are represented by the Sequence model, through which one can
|
|
|
|
|
access the compound's structure-based classification.</p>
|
|
|
|
|
|
|
|
|
|
<h3 id="label-GET">GET</h3>
|
|
|
|
|
|
|
|
|
|
<p><strong>/sequence/fingerprint</strong></p>
|
|
|
|
|
|
|
|
|
|
<p>A (FASTA) sequence's classification can be retrieved in the JSON. In
|
|
|
|
|
this example, the sequence has the fingerprint =
|
|
|
|
|
“8bf70c23ac100cd2c3955081d8613325”</p>
|
|
|
|
|
|
|
|
|
|
<blockquote>
|
|
|
|
|
<p>ClassyFireAPI.get_sequence_classification(“8bf70c23ac100cd2c3955081d8613325”,“json”)</p>
|
|
|
|
|
</blockquote>
|
|
|
|
|
|
|
|
|
|
<p>Where:</p>
|
|
|
|
|
|
|
|
|
|
<blockquote>
|
|
|
|
|
<p>The sequence's fingerprint is “8bf70c23ac100cd2c3955081d8613325”,</p>
|
|
|
|
|
|
2016-03-10 02:55:54 +00:00
|
|
|
<blockquote>
|
|
|
|
|
<p>The fingerprint is generate by Digest::MD5 from the peptide sequence
|
|
|
|
|
“APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS”</p>
|
|
|
|
|
</blockquote>
|
|
|
|
|
|
2016-03-10 02:50:36 +00:00
|
|
|
<p>The output format is “json” (JSON).</p>
|
|
|
|
|
</blockquote>
|
|
|
|
|
</blockquote>
|
|
|
|
|
|
|
|
|
|
<h2 id="label-3.+Query">3. Query</h2>
|
2016-03-10 02:26:59 +00:00
|
|
|
|
|
|
|
|
<blockquote>
|
|
|
|
|
<p>The Query model represents the chemical structure to be classified. Its
|
|
|
|
|
attributes are the query label and the query input.</p>
|
|
|
|
|
|
|
|
|
|
<blockquote>
|
|
|
|
|
<p>The query label is an identifier</p>
|
|
|
|
|
|
|
|
|
|
<p>The query input contains the compound's identifier (optional) and its
|
2016-03-10 02:50:36 +00:00
|
|
|
structural representation, separated by a tab. The chemical structure is
|
2016-03-10 02:26:59 +00:00
|
|
|
represented either in the <a
|
|
|
|
|
href="http://www.daylight.com/dayhtml/doc/theory/theory.smiles.html">Daylight
|
2016-03-10 02:50:36 +00:00
|
|
|
SMILES</a> format, the <a
|
2016-03-10 02:26:59 +00:00
|
|
|
href="http://www.iupac.org/home/publications/e-resources/inchi.html">InChI</a>
|
2016-03-10 02:50:36 +00:00
|
|
|
format. Moreover, the compound can be represented with its <a
|
2016-03-10 02:55:54 +00:00
|
|
|
href="http://www.chem.qmul.ac.uk/iupac/">IUPAC name</a>. The input can also
|
|
|
|
|
be of type <a href="https://en.wikipedia.org/wiki/FASTA_format">FASTA</a>,
|
|
|
|
|
which contains peptide or nucleotide sequences.</p>
|
2016-03-10 02:26:59 +00:00
|
|
|
</blockquote>
|
|
|
|
|
|
|
|
|
|
<h3 id="label-POST">POST</h3>
|
|
|
|
|
|
|
|
|
|
<p>A query can be submitted using the POST method as demonstrated in the
|
|
|
|
|
following example.</p>
|
|
|
|
|
|
|
|
|
|
<blockquote>
|
2016-03-10 02:50:36 +00:00
|
|
|
<p>ClassyFireAPI.submit_query(“curl_test”,“MOL1tCCCOCCnMOL2tCOCC=CCCC”,“STRUCTURE”)
|
|
|
|
|
where the parameters are:</p>
|
2016-03-10 02:26:59 +00:00
|
|
|
|
|
|
|
|
<p>The query label: curl_test,</p>
|
|
|
|
|
|
|
|
|
|
<p>The entity identifiers: MOL1,MOL2</p>
|
|
|
|
|
|
|
|
|
|
<p>The entity's structure represented in the SMILES format: CCCOCC and
|
|
|
|
|
COCC=CCCC.</p>
|
|
|
|
|
|
|
|
|
|
<p>The query is of type 'STRUCTURE'</p>
|
|
|
|
|
</blockquote>
|
|
|
|
|
|
|
|
|
|
<h3 id="label-GET">GET</h3>
|
|
|
|
|
|
|
|
|
|
<p><strong>/queries/queryId</strong></p>
|
|
|
|
|
|
|
|
|
|
<p>The classification results can be retrieved via a GET method in the JSON or
|
|
|
|
|
XML format.</p>
|
|
|
|
|
|
|
|
|
|
<blockquote>
|
|
|
|
|
<p>ClassyFireAPI.get_query(443431,“json”)</p>
|
|
|
|
|
</blockquote>
|
|
|
|
|
|
|
|
|
|
<p>where:</p>
|
|
|
|
|
|
|
|
|
|
<blockquote>
|
|
|
|
|
<p>The query id is 443431, The output format is “json” (JSON)</p>
|
|
|
|
|
</blockquote>
|
|
|
|
|
</blockquote>
|
|
|
|
|
</blockquote>
|
|
|
|
|
|
|
|
|
|
<h1 id="label-Directory+Structure"><strong>Directory Structure</strong></h1>
|
|
|
|
|
<ul><li>
|
|
|
|
|
<p>lib</p>
|
|
|
|
|
</li></ul>
|
|
|
|
|
|
|
|
|
|
<h1 id="label-Who+do+I+talk+to-3F"><strong>Who do I talk to?</strong></h1>
|
|
|
|
|
<ul><li>
|
2016-03-10 02:50:36 +00:00
|
|
|
<p>Yannick Djoumbou Feunang: djoumbou@ualberta.ca</p>
|
2016-03-10 02:26:59 +00:00
|
|
|
</li><li>
|
|
|
|
|
<p>Other community or team contact</p>
|
|
|
|
|
</li></ul>
|
|
|
|
|
</div></div>
|
|
|
|
|
|
|
|
|
|
<div id="footer">
|
2016-06-28 22:52:27 +01:00
|
|
|
Generated on Tue Jun 28 15:46:58 2016 by
|
2016-03-10 02:26:59 +00:00
|
|
|
<a href="http://yardoc.org" title="Yay! A Ruby Documentation Tool" target="_parent">yard</a>
|
2016-06-28 22:52:27 +01:00
|
|
|
0.8.7.6 (ruby-2.4.0).
|
2016-03-10 02:26:59 +00:00
|
|
|
</div>
|
|
|
|
|
|
|
|
|
|
</body>
|
|
|
|
|
</html>
|
